CDS

Accession Number TCMCG068C33705
gbkey CDS
Protein Id KAG5601576.1
Location complement(join(44864087..44864200,44865341..44865454))
Organism Solanum commersonii
locus_tag H5410_032946

Protein

Length 75aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA655804, BioSample:SAMN15755581
db_source JACXVP010000006.1
Definition hypothetical protein H5410_032946 [Solanum commersonii]
Locus_tag H5410_032946

EGGNOG-MAPPER Annotation

COG_category U
Description Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide- sensitive factor) attachment protein receptor
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko04131        [VIEW IN KEGG]
KEGG_ko ko:K08495        [VIEW IN KEGG]
EC -
KEGG_Pathway ko04130        [VIEW IN KEGG]
map04130        [VIEW IN KEGG]
GOs GO:0000139        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0005484        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005515        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005794        [VIEW IN EMBL-EBI]
GO:0005795        [VIEW IN EMBL-EBI]
GO:0005797        [VIEW IN EMBL-EBI]
GO:0005801        [VIEW IN EMBL-EBI]
GO:0006810        [VIEW IN EMBL-EBI]
GO:0006888        [VIEW IN EMBL-EBI]
GO:0006906        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0016050        [VIEW IN EMBL-EBI]
GO:0016192        [VIEW IN EMBL-EBI]
GO:0031090        [VIEW IN EMBL-EBI]
GO:0031201        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0031985        [VIEW IN EMBL-EBI]
GO:0032879        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044431        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046907        [VIEW IN EMBL-EBI]
GO:0048193        [VIEW IN EMBL-EBI]
GO:0048209        [VIEW IN EMBL-EBI]
GO:0048284        [VIEW IN EMBL-EBI]
GO:0050789        [VIEW IN EMBL-EBI]
GO:0050794        [VIEW IN EMBL-EBI]
GO:0051049        [VIEW IN EMBL-EBI]
GO:0051179        [VIEW IN EMBL-EBI]
GO:0051234        [VIEW IN EMBL-EBI]
GO:0051641        [VIEW IN EMBL-EBI]
GO:0051649        [VIEW IN EMBL-EBI]
GO:0060341        [VIEW IN EMBL-EBI]
GO:0060627        [VIEW IN EMBL-EBI]
GO:0061024        [VIEW IN EMBL-EBI]
GO:0061025        [VIEW IN EMBL-EBI]
GO:0065007        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0090174        [VIEW IN EMBL-EBI]
GO:0098588        [VIEW IN EMBL-EBI]
GO:0098791        [VIEW IN EMBL-EBI]
GO:0098796        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGATGGTGTGATTTCTCAAGCTCAAGAAACAATAAAGACACTTATGTTTCAAAGATCAACATTTGGTGGCATTAATTCAAAACTCAGCAATGTCAGCAGTCGCCTCCCAACGGTTAACCATATTCTTTCAGCAATAAAGAAGAAAAAGTCTATGGATACTATCATTCTTTCATTAGTTGCCTCTGTATGCATGTTTCTCATTTTGGTTTACTGGATGACGAAATGA
Protein:  
MDGVISQAQETIKTLMFQRSTFGGINSKLSNVSSRLPTVNHILSAIKKKKSMDTIILSLVASVCMFLILVYWMTK